NAF1 blocking peptide
NAF1 Peptide - middle region
Reactivity
Human
Synonyms
NAF1; NAF1 Peptide - middle region; NAF1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFN
Sequence Length
389
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NAF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NAF1 Antibody, made
Target Description: RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.
Target Description: RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.
Product Categories/Family for NAF1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
H/ACA ribonucleoprotein complex non-core subunit NAF1 isoform b
NCBI Official Synonym Full Names
nuclear assembly factor 1 ribonucleoprotein
NCBI Official Symbol
NAF1
NCBI Protein Information
H/ACA ribonucleoprotein complex non-core subunit NAF1
UniProt Protein Name
H/ACA ribonucleoprotein complex non-core subunit NAF1
Protein Family
UniProt Gene Name
NAF1
UniProt Synonym Gene Names
hNAF1
UniProt Entry Name
NAF1_HUMAN
Research Articles on NAF1
Similar Products
Product Notes
The NAF1 naf1 (Catalog #AAA3248134) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NAF1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDKGSDASWK NDQEPPPEAL DFSDDEKEKE AKQRKKSQIQ GRKKLKSEFN. It is sometimes possible for the material contained within the vial of "NAF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
