MVP blocking peptide

MVP Peptide - middle region

Cat. Num. AAA3244645

• Gene Names: MVP; LRP; VAULT1
• Reactivity: Human
• Synonyms: MVP; MVP Peptide - middle region; MVP blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYR
• Sequence Length: 893

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for MVP blocking peptide

This is a synthetic peptide designed for use in combination with anti-MVP Antibody, made

Target Description: This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene.

Product Categories/Family for MVP blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 19913410
• NCBI GeneID: 9961
• NCBI Accession #: NP_059447
• NCBI GenBank Nucleotide #: NM_017458.3
• UniProt Accession #: Q14764
• Molecular Weight: 98kDa
• NCBI Official Full Name: major vault protein isoform 1
• NCBI Official Synonym Full Names: major vault protein
• NCBI Official Symbol: MVP
• NCBI Official Synonym Symbols: LRP; VAULT1
• NCBI Protein Information: major vault protein
• UniProt Protein Name: Major vault protein
• Protein Family: Hyperpolarization-activated voltage-gated potassium channel
• UniProt Gene Name: MVP
• UniProt Synonym Gene Names: LRP; MVP
• UniProt Entry Name: MVP_HUMAN

NCBI Description

This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012]

Uniprot Description

MVP: Required for normal vault structure. Vaults are multi- subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo- cytoplasmic transport. Down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoskeleton; membrane; perinuclear region of cytoplasm; cytoplasm; nuclear pore; nucleus; ribonucleoprotein complex

Molecular Function: protein binding; protein phosphatase binding; protein kinase binding

Biological Process: cell proliferation; protein transport; mRNA transport; negative regulation of protein amino acid autophosphorylation