MTMR2 blocking peptide

MTMR2 Peptide - C-terminal region

Cat. Num. AAA3244809

• Gene Names: MTMR2; CMT4B; CMT4B1
• Reactivity: Human
• Synonyms: MTMR2; MTMR2 Peptide - C-terminal region; MTMR2 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISN
• Sequence Length: 643

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for MTMR2 blocking peptide

This is a synthetic peptide designed for use in combination with anti-MTMR2 Antibody, made

Target Description: This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.

Product Categories/Family for MTMR2 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 343790884
• NCBI GeneID: 8898
• NCBI Accession #: NP_001230500
• NCBI GenBank Nucleotide #: NM_001243571.1
• UniProt Accession #: Q13614
• Molecular Weight: 70kDa
• NCBI Official Full Name: myotubularin-related protein 2 isoform 2
• NCBI Official Synonym Full Names: myotubularin related protein 2
• NCBI Official Symbol: MTMR2
• NCBI Official Synonym Symbols: CMT4B; CMT4B1
• NCBI Protein Information: myotubularin-related protein 2
• UniProt Protein Name: Myotubularin-related protein 2
• Protein Family: Myotubularin-related protein
• UniProt Gene Name: MTMR2
• UniProt Entry Name: MTMR2_HUMAN

NCBI Description

This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011]