MRPL51 blocking peptide

MRPL51 Peptide - middle region

Cat. Num. AAA3245770

• Gene Names: MRPL51; CDA09; MRP64; bMRP64; HSPC241
• Reactivity: Human
• Synonyms: MRPL51; MRPL51 Peptide - middle region; MRPL51 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGI
• Sequence Length: 128

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for MRPL51 blocking peptide

This is a synthetic peptide designed for use in combination with anti-MRPL51 Antibody, made

Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q.

Product Categories/Family for MRPL51 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 16950607
• NCBI GeneID: 51258
• NCBI Accession #: NP_057581.2
• NCBI GenBank Nucleotide #: NM_016497.3
• UniProt Accession #: Q4U2R6
• Molecular Weight: 14 kDa
• NCBI Official Full Name: 39S ribosomal protein L51, mitochondrial
• NCBI Official Synonym Full Names: mitochondrial ribosomal protein L51
• NCBI Official Symbol: MRPL51
• NCBI Official Synonym Symbols: CDA09; MRP64; bMRP64; HSPC241
• NCBI Protein Information: 39S ribosomal protein L51, mitochondrial
• UniProt Protein Name: 39S ribosomal protein L51, mitochondrial
• Protein Family: 39S ribosomal protein
• UniProt Gene Name: MRPL51
• UniProt Synonym Gene Names: MRP64; L51mt; MRP-L51; bMRP64
• UniProt Entry Name: RM51_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPL51: Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 12p13.3-p13.1

Cellular Component: mitochondrial inner membrane; mitochondrial ribosome; mitochondrial large ribosomal subunit

Molecular Function: protein binding; structural constituent of ribosome

Biological Process: mitochondrial translation; translation; organelle organization and biogenesis