Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MIA3 blocking peptide

MIA3 Peptide - C-terminal region

Gene Names
MIA3; ARNT; D320; TANGO; TANGO1; UNQ6077
Reactivity
Human
Synonyms
MIA3; MIA3 Peptide - C-terminal region; MIA3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GSLGPREYFIPGTRLPPPTHGPQEYPPPPAVRDLLPSGSRDEPPPASQST
Sequence Length
785
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MIA3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- MIA3 Antibody, made

Target Description: Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. It may participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. It is also specifically required for the secretion of lipoproteins by participating in their export from the endoplasmic reticulum.
Product Categories/Family for MIA3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86 kDa
NCBI Official Full Name
transport and Golgi organization protein 1 homolog isoform 2
NCBI Official Synonym Full Names
MIA SH3 domain ER export factor 3
NCBI Official Symbol
MIA3
NCBI Official Synonym Symbols
ARNT; D320; TANGO; TANGO1; UNQ6077
NCBI Protein Information
transport and Golgi organization protein 1 homolog
UniProt Protein Name
Melanoma inhibitory activity protein 3
UniProt Gene Name
MIA3
UniProt Synonym Gene Names
KIAA0268; TANGO; TANGO1
UniProt Entry Name
MIA3_HUMAN

Uniprot Description

MIA3: Required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. May participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. Belongs to the MIA/OTOR family. Tango1 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: endoplasmic reticulum membrane; membrane; intracellular membrane-bound organelle; integral to membrane

Molecular Function: protein binding

Biological Process: protein transport; exocytosis; collagen fibril organization; wound healing; positive regulation of leukocyte migration; chondrocyte development; negative regulation of cell adhesion; positive regulation of bone mineralization; negative regulation of cell migration

Research Articles on MIA3

Similar Products

Product Notes

The MIA3 mia3 (Catalog #AAA3247378) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MIA3 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSLGPREYFI PGTRLPPPTH GPQEYPPPPA VRDLLPSGSR DEPPPASQST. It is sometimes possible for the material contained within the vial of "MIA3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.