Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MED14 blocking peptide

MED14 Peptide - middle region

Gene Names
MED14; CSRP; RGR1; CRSP2; EXLM1; CXorf4; CRSP150; DRIP150; TRAP170
Reactivity
Human
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot
Synonyms
MED14; MED14 Peptide - middle region; MED14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
Sequence Length
1454
Applicable Applications for MED14 blocking peptide
Chromatin IP (ChIP), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MED14 blocking peptide
This is a synthetic peptide designed for use in combination with anti-MED14 Antibody, made

Target Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Product Categories/Family for MED14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 14
NCBI Official Synonym Full Names
mediator complex subunit 14
NCBI Official Symbol
MED14
NCBI Official Synonym Symbols
CSRP; RGR1; CRSP2; EXLM1; CXorf4; CRSP150; DRIP150; TRAP170
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 14
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 14
UniProt Gene Name
MED14
UniProt Synonym Gene Names
ARC150; CRSP2; CXorf4; DRIP150; EXLM1; RGR1; TRAP170; ARC150; CRSP complex subunit 2; hRGR1; Trap170; DRIP150
UniProt Entry Name
MED14_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation. [provided by RefSeq, Jul 2008]

Uniprot Description

Trap170: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Belongs to the Mediator complex subunit 14 family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xp11.4

Cellular Component: nucleoplasm; membrane; Srb-mediator complex; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; vitamin D receptor binding; transcription coactivator activity; transcription cofactor activity; thyroid hormone receptor binding; receptor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; stem cell maintenance; androgen receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter

Research Articles on MED14

Similar Products

Product Notes

The MED14 med14 (Catalog #AAA3238701) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MED14 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED14 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Western Blot (WB). Researchers should empirically determine the suitability of the MED14 med14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AADREDSPAM ALLLQQFKEN IQDLVFRTKT GKQTRTNAKR KLSDDPCPVE. It is sometimes possible for the material contained within the vial of "MED14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.