Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MDM2 blocking peptide

MDM2 Peptide - middle region

Gene Names
MDM2; HDMX; hdm2; ACTFS
Reactivity
Human
Synonyms
MDM2; MDM2 Peptide - middle region; MDM2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKA
Sequence Length
446
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MDM2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-MDM2 Antibody, made

Target Description: This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Product Categories/Family for MDM2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase Mdm2 isoform a
NCBI Official Synonym Full Names
MDM2 proto-oncogene
NCBI Official Symbol
MDM2
NCBI Official Synonym Symbols
HDMX; hdm2; ACTFS
NCBI Protein Information
E3 ubiquitin-protein ligase Mdm2
UniProt Protein Name
E3 ubiquitin-protein ligase Mdm2
Protein Family
UniProt Gene Name
MDM2
UniProt Synonym Gene Names
Hdm2
UniProt Entry Name
MDM2_HUMAN

NCBI Description

This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells. [provided by RefSeq, Jun 2013]

Uniprot Description

MDM2: a ubiquitin ligase for p53, plays a central role in regulation of the stability of p53 via Akt-mediated MDM2 phosphorylation. Phosphorylation of MDM2 increases its interaction with p300, providing a platform to allow the assembly of the protein complex necessary for MDM2-mediated ubiquitination and degradation of p53. Phosphorylation of MDM2 also blocks its binding to p19ARF, increasing the degradation of p53. Facilitates the nuclear export of p53 and targets it for proteasome-mediated proteolysis. Eight alternatively spliced isoforms have been reported.

Protein type: Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin ligase; Oncoprotein; Inhibitor; Ubiquitin conjugating system; Nucleolus

Chromosomal Location of Human Ortholog: 12q14.3-q15

Cellular Component: nucleoplasm; nuclear body; protein complex; cytoplasm; nucleolus; plasma membrane; synapse; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; peroxisome proliferator activated receptor binding; enzyme binding; zinc ion binding; p53 binding; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: viral reproduction; nerve growth factor receptor signaling pathway; protein ubiquitination during ubiquitin-dependent protein catabolic process; protein ubiquitination; response to morphine; negative regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; response to carbohydrate stimulus; response to antibiotic; positive regulation of protein export from nucleus; synaptic transmission; negative regulation of DNA damage response, signal transduction by p53 class mediator; response to magnesium ion; establishment of protein localization; peptidyl-lysine modification; positive regulation of cell proliferation; protein complex assembly; response to iron ion; epidermal growth factor receptor signaling pathway; response to drug; traversing start control point of mitotic cell cycle; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; protein destabilization; response to ether; response to cocaine; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; innate immune response; regulation of protein catabolic process; negative regulation of transcription, DNA-dependent

Disease: Accelerated Tumor Formation, Susceptibility To

Research Articles on MDM2

Similar Products

Product Notes

The MDM2 mdm2 (Catalog #AAA3244752) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MDM2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: EISLADYWKC TSCNEMNPPL PSHCNRCWAL RENWLPEDKG KDKGEISEKA. It is sometimes possible for the material contained within the vial of "MDM2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.