Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MBD4 blocking peptide

MBD4 Peptide - middle region

Gene Names
MBD4; MED1
Reactivity
Human
Synonyms
MBD4; MBD4 Peptide - middle region; MBD4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKYNKEALSPPRRK
Sequence Length
580
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MBD4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- MBD4 Antibody, made

Target Description: The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains an MBD domain at the N-terminus that functions both in binding to methylated DNA and in protein interactions and a C-terminal mismatch-specific glycosylase domain that is involved in DNA repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for MBD4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
methyl-CpG-binding domain protein 4 isoform 2
NCBI Official Synonym Full Names
methyl-CpG binding domain 4, DNA glycosylase
NCBI Official Symbol
MBD4
NCBI Official Synonym Symbols
MED1
NCBI Protein Information
methyl-CpG-binding domain protein 4
UniProt Protein Name
Methyl-CpG-binding domain protein 4
UniProt Gene Name
MBD4
UniProt Synonym Gene Names
MED1
UniProt Entry Name
MBD4_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains an MBD domain at the N-terminus that functions both in binding to methylated DNA and in protein interactions and a C-terminal mismatch-specific glycosylase domain that is involved in DNA repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

MBD4: Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage; EC 3.2.2.-; Apoptosis; Deoxyribonuclease

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; chromatin

Molecular Function: protein binding; satellite DNA binding; pyrimidine-specific mismatch base pair DNA N-glycosylase activity; endodeoxyribonuclease activity

Biological Process: response to radiation; base-excision repair, AP site formation; DNA damage response, signal transduction resulting in induction of apoptosis; depyrimidination; base-excision repair; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA repair; DNA catabolic process, endonucleolytic

Research Articles on MBD4

Similar Products

Product Notes

The MBD4 mbd4 (Catalog #AAA3247037) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MBD4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNCSPTRKDF TGEKIFQEDT IPRTQIERRK TSLYFSSKYN KEALSPPRRK. It is sometimes possible for the material contained within the vial of "MBD4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.