Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LITAF blocking peptide

LITAF Peptide - N-terminal region

Gene Names
LITAF; PIG7; SIMPLE; TP53I7
Reactivity
Human
Applications
Western Blot
Synonyms
LITAF; LITAF Peptide - N-terminal region; LITAF blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN
Sequence Length
228
Applicable Applications for LITAF blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LITAF blocking peptide
This is a synthetic peptide designed for use in combination with anti-LITAF Antibody, made

Target Description: Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for LITAF blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
lipopolysaccharide-induced tumor necrosis factor-alpha factor isoform 1
NCBI Official Synonym Full Names
lipopolysaccharide induced TNF factor
NCBI Official Symbol
LITAF
NCBI Official Synonym Symbols
PIG7; SIMPLE; TP53I7
NCBI Protein Information
lipopolysaccharide-induced tumor necrosis factor-alpha factor
UniProt Protein Name
Lipopolysaccharide-induced tumor necrosis factor-alpha factor
UniProt Gene Name
LITAF
UniProt Synonym Gene Names
PIG7; SIMPLE; LPS-induced TNF-alpha factor
UniProt Entry Name
LITAF_HUMAN

NCBI Description

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

LITAF: Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF- alpha) gene expression. Interacts with NEDD4. Interacts with WWOX. Isoform 2 may interact with STAT6. By bacterial lipopolysaccharides (LPS) or p53/TP53. In monocytes by the Bacillus Calmette-Guerin (BCG). Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 16p13.13

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; lysosomal membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; signal transducer activity; WW domain binding

Biological Process: regulation of transcription from RNA polymerase II promoter; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; apoptosis; negative regulation of NF-kappaB import into nucleus; signal transduction; aging; regulation of cytokine production

Disease: Charcot-marie-tooth Disease, Demyelinating, Type 1c

Research Articles on LITAF

Similar Products

Product Notes

The LITAF litaf (Catalog #AAA3244392) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LITAF Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LITAF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LITAF litaf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSYEETVAVN SYYPTPPAPM PGPTTGLVTG PDGKGMNPPS YYTQPAPIPN. It is sometimes possible for the material contained within the vial of "LITAF, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.