Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LGALS3 blocking peptide

LGALS3 Peptide - N-terminal region

Gene Names
LGALS3; L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Reactivity
Human
Applications
Western Blot
Synonyms
LGALS3; LGALS3 Peptide - N-terminal region; LGALS3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAY
Sequence Length
250
Applicable Applications for LGALS3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LGALS3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-LGALS3 Antibody, made

Target Description: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. Alternate splicing results in multiple transcript variants.
Product Categories/Family for LGALS3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
galectin-3 isoform 1
NCBI Official Synonym Full Names
galectin 3
NCBI Official Symbol
LGALS3
NCBI Official Synonym Symbols
L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
NCBI Protein Information
galectin-3
UniProt Protein Name
Galectin-3
UniProt Gene Name
LGALS3
UniProt Synonym Gene Names
MAC2; Gal-3; CBP 35; GALBP
UniProt Entry Name
LEG3_HUMAN

NCBI Description

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]

Uniprot Description

Galectin-3: galactose-specific lectin which binds IgE. Expressed at a high level in the colonic epithelium. Also abundant in activated macrophages.

Protein type: Cell surface; Motility/polarity/chemotaxis; Extracellular matrix

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: extracellular matrix; spliceosome; extracellular space; proteinaceous extracellular matrix; membrane; mitochondrial inner membrane; cytoplasm; plasma membrane; immunological synapse; nucleus; external side of plasma membrane

Molecular Function: protein binding; laminin binding; IgE binding; carbohydrate binding; chemoattractant activity

Biological Process: monocyte chemotaxis; neutrophil chemotaxis; extracellular matrix organization and biogenesis; epithelial cell differentiation; positive chemotaxis; RNA splicing; negative regulation of endocytosis; regulation of T cell proliferation; eosinophil chemotaxis; negative regulation of T cell receptor signaling pathway; innate immune response; mRNA processing; skeletal development; macrophage chemotaxis

Research Articles on LGALS3

Similar Products

Product Notes

The LGALS3 lgals3 (Catalog #AAA3244062) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LGALS3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LGALS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LGALS3 lgals3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSLHDALSGS GNPNPQGWPG AWGNQPAGAG GYPGASYPGA YPGQAPPGAY. It is sometimes possible for the material contained within the vial of "LGALS3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.