Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KANK2 blocking peptide

KANK2 Peptide - C-terminal region

Gene Names
KANK2; SIP; MXRA3; PPKWH; NPHS16; ANKRD25
Reactivity
Human
Applications
Western Blot
Synonyms
KANK2; KANK2 Peptide - C-terminal region; KANK2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQ
Sequence Length
851
Applicable Applications for KANK2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KANK2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-KANK2 Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for KANK2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
KN motif and ankyrin repeat domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
KN motif and ankyrin repeat domains 2
NCBI Official Symbol
KANK2
NCBI Official Synonym Symbols
SIP; MXRA3; PPKWH; NPHS16; ANKRD25
NCBI Protein Information
KN motif and ankyrin repeat domain-containing protein 2
UniProt Protein Name
KN motif and ankyrin repeat domain-containing protein 2
UniProt Gene Name
KANK2
UniProt Synonym Gene Names
ANKRD25; KIAA1518; MXRA3; SIP; SIP; SRC-interacting protein
UniProt Entry Name
KANK2_HUMAN

NCBI Description

This gene encodes a member of the KN motif and ankyrin repeat domains (KANK) family of proteins, which play a role in cytoskeletal formation by regulating actin polymerization. The encoded protein functions in the sequestration of steroid receptor coactivators and possibly other proteins. Mutations in this gene are associated with impaired kidney podocyte function and nephrotic syndrome, and keratoderma and woolly hair. [provided by RefSeq, Jul 2016]

Uniprot Description

ANKRD25: a mammalian growth regulatory protein containing five Ankyrin repeats, common protein-protein interaction motifs. Ankyrin repeats are found in proteins with diverse functions including transcriptional initiators, cell-cycle regulators, cytoskeletal, and ion transporters. Three alternatively spliced isoforms have been described.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: mitochondrion; cytoplasm

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; transcription, DNA-dependent; apoptosis; negative regulation of programmed cell death; negative regulation of transcription from RNA polymerase II promoter; negative regulation of estrogen receptor signaling pathway

Disease: Palmoplantar Keratoderma And Woolly Hair

Research Articles on KANK2

Similar Products

Product Notes

The KANK2 kank2 (Catalog #AAA3240586) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KANK2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KANK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KANK2 kank2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DSGVCKVDKQ NRAGYSPIML TALATLKTQD DIETVLQLFR LGNINAKASQ. It is sometimes possible for the material contained within the vial of "KANK2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.