Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ITIH2 blocking peptide

ITIH2 Peptide - C-terminal region

Gene Names
ITIH2; H2P; SHAP
Reactivity
Human
Synonyms
ITIH2; ITIH2 Peptide - C-terminal region; ITIH2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NVDFLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASM
Sequence Length
946
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ITIH2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ITIH2 Antibody, made

Target Description: The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain and a variable number of heavy chains.
Product Categories/Family for ITIH2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106 kDa
NCBI Official Full Name
inter-alpha-trypsin inhibitor heavy chain H2
NCBI Official Synonym Full Names
inter-alpha-trypsin inhibitor heavy chain 2
NCBI Official Symbol
ITIH2
NCBI Official Synonym Symbols
H2P; SHAP
NCBI Protein Information
inter-alpha-trypsin inhibitor heavy chain H2
UniProt Protein Name
Inter-alpha-trypsin inhibitor heavy chain H2
UniProt Gene Name
ITIH2
UniProt Synonym Gene Names
IGHEP2; ITI heavy chain H2; ITI-HC2; Inter-alpha-inhibitor heavy chain 2; SHAP
UniProt Entry Name
ITIH2_HUMAN

NCBI Description

The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain (see MIM 176870) and a variable number of heavy chains (Salier et al., 1987 [PubMed 2446322]; Himmelfarb et al., 2004 [PubMed 14744536]).[supplied by OMIM, Nov 2009]

Uniprot Description

ITIH2: May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes. Belongs to the ITIH family.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Chromosomal Location of Human Ortholog: 10p15

Cellular Component: extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity

Biological Process: hyaluronan metabolic process

Research Articles on ITIH2

Similar Products

Product Notes

The ITIH2 itih2 (Catalog #AAA3246802) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ITIH2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVDFLGIYIP PTNKFSPKAH GLIGQFMQEP KIHIFNERPG KDPEKPEASM. It is sometimes possible for the material contained within the vial of "ITIH2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.