Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IL13RA1 blocking peptide

IL13RA1 Peptide - N-terminal region

Gene Names
IL13RA1; NR4; CT19; CD213A1; IL-13Ra
Reactivity
Human
Synonyms
IL13RA1; IL13RA1 Peptide - N-terminal region; IL13RA1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVE
Sequence Length
427
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IL13RA1 blocking peptide
The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
Product Categories/Family for IL13RA1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
interleukin-13 receptor subunit alpha-1
NCBI Official Synonym Full Names
interleukin 13 receptor subunit alpha 1
NCBI Official Symbol
IL13RA1
NCBI Official Synonym Symbols
NR4; CT19; CD213A1; IL-13Ra
NCBI Protein Information
interleukin-13 receptor subunit alpha-1
UniProt Protein Name
Interleukin-13 receptor subunit alpha-1
Protein Family
UniProt Gene Name
IL13RA1
UniProt Synonym Gene Names
IL13R; IL13RA; IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL-13R-alpha-1; IL-13RA1; CT19
UniProt Entry Name
I13R1_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4. [provided by RefSeq, Jul 2008]

Uniprot Description

IL13R: Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity. Belongs to the type I cytokine receptor family. Type 5 subfamily.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: interleukin-13 receptor complex; plasma membrane

Molecular Function: protein binding; interleukin-13 receptor activity

Biological Process: positive regulation of immunoglobulin production; cell surface receptor linked signal transduction; positive regulation of B cell proliferation

Research Articles on IL13RA1

Similar Products

Product Notes

The IL13RA1 il13ra1 (Catalog #AAA3240914) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IL13RA1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFSHFGDKQD KKIAPETRRS IEVPLNERIC LQVGSQCSTN ESEKPSILVE. It is sometimes possible for the material contained within the vial of "IL13RA1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.