Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IL12A blocking peptide

IL12A Peptide - middle region

Gene Names
IL12A; P35; CLMF; NFSK; NKSF1; IL-12A
Reactivity
Human
Applications
Western Blot
Synonyms
IL12A; IL12A Peptide - middle region; IL12A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLN
Sequence Length
219
Applicable Applications for IL12A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IL12A blocking peptide
This is a synthetic peptide designed for use in combination with anti-IL12A, made

Target Description: This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.
Product Categories/Family for IL12A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
interleukin-12 subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 12A
NCBI Official Symbol
IL12A
NCBI Official Synonym Symbols
P35; CLMF; NFSK; NKSF1; IL-12A
NCBI Protein Information
interleukin-12 subunit alpha
UniProt Protein Name
Interleukin-12 subunit alpha
Protein Family
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
NKSF1; IL-12A; CLMF p35; NKSF1
UniProt Entry Name
IL12A_HUMAN

NCBI Description

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

Uniprot Description

IL12A: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. Belongs to the IL-6 superfamily.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 3q25.33

Cellular Component: extracellular space; interleukin-12 complex; cytoplasm

Molecular Function: protein binding; interleukin-27 binding; growth factor activity; interleukin-12 beta subunit binding; protein heterodimerization activity; cytokine activity; interleukin-12 receptor binding

Biological Process: positive regulation of NK T cell activation; cell migration; positive regulation of cell adhesion; positive regulation of T cell mediated cytotoxicity; negative regulation of smooth muscle cell proliferation; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; response to virus; positive regulation of tyrosine phosphorylation of Stat4 protein; response to lipopolysaccharide; defense response to protozoan; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell activation; response to UV-B; positive regulation of interferon-gamma production; defense response to Gram-positive bacterium; negative regulation of interleukin-17 production; positive regulation of T cell differentiation; positive regulation of mononuclear cell proliferation; positive regulation of lymphocyte proliferation; positive regulation of T cell proliferation; immune response; cell cycle arrest

Research Articles on IL12A

Similar Products

Product Notes

The IL12A il12a (Catalog #AAA3245588) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IL12A Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL12A il12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNMLQKARQT LEFYPCTSEE IDHEDITKDK TSTVEACLPL ELTKNESCLN. It is sometimes possible for the material contained within the vial of "IL12A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.