Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IFNAR1 blocking peptide

IFNAR1 Peptide - C-terminal region

Gene Names
IFNAR1; AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC
Reactivity
Human
Applications
Western Blot
Synonyms
IFNAR1; IFNAR1 Peptide - C-terminal region; IFNAR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK
Sequence Length
557
Applicable Applications for IFNAR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IFNAR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-IFNAR1 Antibody, made

Target Description: The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Product Categories/Family for IFNAR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
interferon alpha/beta receptor 1
NCBI Official Synonym Full Names
interferon alpha and beta receptor subunit 1
NCBI Official Symbol
IFNAR1
NCBI Official Synonym Symbols
AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC
NCBI Protein Information
interferon alpha/beta receptor 1
UniProt Protein Name
Interferon alpha/beta receptor 1
UniProt Gene Name
IFNAR1
UniProt Synonym Gene Names
IFNAR; IFN-R-1; IFN-alpha/beta receptor 1; CRF2-1
UniProt Entry Name
INAR1_HUMAN

NCBI Description

The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]

Uniprot Description

IFNAR1: receptor for interferons alpha and beta. Belongs to the type II cytokine family of receptors. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. Present in all tissues and even on the surface of most IFN-resistant cells.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; interferon receptor activity; interferon-alpha/beta receptor activity

Biological Process: positive regulation of interferon-gamma production; cell surface receptor linked signal transduction; T cell activation; response to virus; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-1 beta secretion; JAK-STAT cascade; interferon type I biosynthetic process; defense response to virus

Research Articles on IFNAR1

Similar Products

Product Notes

The IFNAR1 ifnar1 (Catalog #AAA3244271) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IFNAR1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFNAR1 ifnar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIEKCFIIEN ISTIATVEET NQTDEDHKKY SSQTSQDSGN YSNEDESESK. It is sometimes possible for the material contained within the vial of "IFNAR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.