Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HSD17B3 blocking peptide

HSD17B3 Peptide - middle region

Gene Names
HSD17B3; EDH17B3; SDR12C2
Reactivity
Human
Synonyms
HSD17B3; HSD17B3 Peptide - middle region; HSD17B3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQR
Sequence Length
310
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HSD17B3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- HSD17B3 Antibody, made

Target Description: This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia.
Product Categories/Family for HSD17B3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
testosterone 17-beta-dehydrogenase 3
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 3
NCBI Official Symbol
HSD17B3
NCBI Official Synonym Symbols
EDH17B3; SDR12C2
NCBI Protein Information
testosterone 17-beta-dehydrogenase 3
UniProt Protein Name
Testosterone 17-beta-dehydrogenase 3
UniProt Gene Name
HSD17B3
UniProt Synonym Gene Names
EDH17B3; 17-beta-HSD 3
UniProt Entry Name
DHB3_HUMAN

NCBI Description

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq, Jul 2008]

Uniprot Description

HSD17B3: Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH. Defects in HSD17B3 are the cause of male pseudohermaphrodism with gynecomastia (MPH). These individuals have unambiguous female external genitalia at birth, but fail to menstruate at the time of expected puberty and instead virilize as evidenced by growth of the phallus. Breast development may or may not take place. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: EC 1.1.1.64; Oxidoreductase; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: testosterone 17-beta-dehydrogenase (NADP+) activity

Biological Process: steroid metabolic process; male genitalia development; androgen biosynthetic process

Disease: 17-beta Hydroxysteroid Dehydrogenase Iii Deficiency

Research Articles on HSD17B3

Similar Products

Product Notes

The HSD17B3 hsd17b3 (Catalog #AAA3248604) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HSD17B3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITKTADEFVK ESLNYVTIGG ETCGCLAHEI LAGFLSLIPA WAFYSGAFQR. It is sometimes possible for the material contained within the vial of "HSD17B3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.