Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GRIN1 blocking peptide

GRIN1 Peptide - C-terminal region

Gene Names
GRIN1; NR1; MRD8; GluN1; NMDA1; NDHMSD; NDHMSR; NMD-R1; NMDAR1
Reactivity
Human
Applications
Western Blot
Synonyms
GRIN1; GRIN1 Peptide - C-terminal region; GRIN1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRA
Sequence Length
938
Applicable Applications for GRIN1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GRIN1 blocking peptide
The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Product Categories/Family for GRIN1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105 kDa
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 1 isoform GluN1-4a
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit 1
NCBI Official Symbol
GRIN1
NCBI Official Synonym Symbols
NR1; MRD8; GluN1; NMDA1; NDHMSD; NDHMSR; NMD-R1; NMDAR1
NCBI Protein Information
glutamate receptor ionotropic, NMDA 1
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 1
UniProt Gene Name
GRIN1
UniProt Synonym Gene Names
NMDAR1; GluN1; NMD-R1
UniProt Entry Name
NMDZ1_HUMAN

NCBI Description

The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

NMDAR1: a subunit of N-methyl-D-aspartate (NMDA) receptors, members of the glutamate receptor channel superfamily. Possesses high calcium permeability and voltage-dependent sensitivity to magnesium and is modulated by glycine. Plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. Mediates neuronal functions in glutamate neurotransmission. Three alternatively-spliced isoforms have been described.

Protein type: Membrane protein, multi-pass; Channel, calcium; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: neuron projection; cell surface; endoplasmic reticulum; integral to plasma membrane; dendrite; postsynaptic density; dendritic spine; excitatory synapse; terminal button; N-methyl-D-aspartate selective glutamate receptor complex; postsynaptic membrane; synaptic vesicle; plasma membrane; synapse; cell junction

Molecular Function: voltage-gated cation channel activity; neurotransmitter binding; glutamate receptor binding; calcium channel activity; calcium ion binding; calmodulin binding; protein binding; enzyme binding; extracellular-glutamate-gated ion channel activity; glutamate binding; protein heterodimerization activity; N-methyl-D-aspartate selective glutamate receptor activity; glycine binding

Biological Process: regulation of long-term neuronal synaptic plasticity; axon guidance; male mating behavior; prepulse inhibition; adult locomotory behavior; positive regulation of apoptosis; regulation of dendrite morphogenesis; rhythmic process; response to morphine; regulation of axonogenesis; sensory perception of pain; calcium ion homeostasis; synaptic transmission; regulation of respiratory gaseous exchange; conditioned taste aversion; ephrin receptor signaling pathway; visual learning; negative regulation of neuron apoptosis; protein tetramerization; cation transport; synaptic transmission, glutamatergic; response to amphetamine; social behavior; respiratory gaseous exchange; pons maturation; cellular calcium ion homeostasis; regulation of membrane potential; response to ethanol; regulation of synaptogenesis; long-term memory; suckling behavior; olfactory learning; propylene metabolic process; ionotropic glutamate receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; cerebral cortex development; regulation of excitatory postsynaptic membrane potential; response to calcium ion

Disease: Mental Retardation, Autosomal Dominant 8

Research Articles on GRIN1

Similar Products

Product Notes

The GRIN1 grin1 (Catalog #AAA3245606) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GRIN1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRIN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRIN1 grin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEIAYKRHKD ARRKQMQLAF AAVNVWRKNL QDRKSGRAEP DPKKKATFRA. It is sometimes possible for the material contained within the vial of "GRIN1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.