Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GPR37L1 blocking peptide

GPR37L1 Peptide - C-terminal region

Gene Names
GPR37L1; ETBRLP2; ETBR-LP-2; ET(B)R-LP-2
Reactivity
Human
Applications
Western Blot
Synonyms
GPR37L1; GPR37L1 Peptide - C-terminal region; GPR37L1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLT
Sequence Length
481
Applicable Applications for GPR37L1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GPR37L1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GPR37L1 Antibody, made

Target Description: GPR37L1 is a orphan receptor.
Product Categories/Family for GPR37L1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
G-protein coupled receptor 37-like 1
NCBI Official Synonym Full Names
G protein-coupled receptor 37 like 1
NCBI Official Symbol
GPR37L1
NCBI Official Synonym Symbols
ETBRLP2; ETBR-LP-2; ET(B)R-LP-2
NCBI Protein Information
G-protein coupled receptor 37-like 1; prosaposin receptor GPR37L1
UniProt Protein Name
Endothelin B receptor-like protein 2
Protein Family
UniProt Gene Name
GPR37L1
UniProt Synonym Gene Names
ETBRLP2; ETBR-LP-2
UniProt Entry Name
ETBR2_HUMAN

Uniprot Description

GPR37L1: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: plasma membrane; integral to membrane; receptor complex

Molecular Function: protein binding; peptide receptor activity, G-protein coupled; peptide binding

Biological Process: negative regulation of neuron differentiation; positive regulation of MAPKKK cascade; negative regulation of smoothened signaling pathway; negative regulation of astrocyte differentiation; G-protein signaling, adenylate cyclase inhibiting pathway; positive regulation of granule cell precursor proliferation

Research Articles on GPR37L1

Similar Products

Product Notes

The GPR37L1 gpr37l1 (Catalog #AAA3240564) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GPR37L1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR37L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR37L1 gpr37l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CYFCLPILFT VTCQLVTWRV RGPPGRKSEC RASKHEQCES QLNSTVVGLT. It is sometimes possible for the material contained within the vial of "GPR37L1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.