Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GOSR2 blocking peptide

GOSR2 Peptide - N-terminal region

Gene Names
GOSR2; Bos1; EPM6; GS27
Reactivity
Human
Applications
Western Blot
Synonyms
GOSR2; GOSR2 Peptide - N-terminal region; GOSR2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQ
Sequence Length
212
Applicable Applications for GOSR2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GOSR2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GOSR2 Antibody, made

Target Description: This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene.
Product Categories/Family for GOSR2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
Golgi SNAP receptor complex member 2 isoform A
NCBI Official Synonym Full Names
golgi SNAP receptor complex member 2
NCBI Official Symbol
GOSR2
NCBI Official Synonym Symbols
Bos1; EPM6; GS27
NCBI Protein Information
Golgi SNAP receptor complex member 2
UniProt Protein Name
Golgi SNAP receptor complex member 2
UniProt Gene Name
GOSR2
UniProt Synonym Gene Names
GS27
UniProt Entry Name
GOSR2_HUMAN

NCBI Description

This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]

Uniprot Description

GOSR2: Involved in transport of proteins from the cis/medial- Golgi to the trans-Golgi network. Defects in GOSR2 are the cause of progressive myoclonic epilepsy type 6 (EPM6). A neurologic disorder characterized by onset of ataxia in the first years of life, followed by action myoclonus and seizures later in childhood, and loss of independent ambulation in the second decade. Cognition is not usually affected, although mild memory difficulties may occur in the third decade. Belongs to the GOSR2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: Golgi membrane; SNARE complex; Golgi apparatus; endoplasmic reticulum membrane; Golgi stack; membrane; late endosome membrane; integral to membrane

Molecular Function: SNAP receptor activity; SNARE binding; transporter activity

Biological Process: intra-Golgi vesicle-mediated transport; ER to Golgi vesicle-mediated transport; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; unfolded protein response; Golgi to vacuole transport; vesicle fusion with Golgi apparatus; protein targeting to vacuole; retrograde transport, endosome to Golgi

Disease: Epilepsy, Progressive Myoclonic 6

Research Articles on GOSR2

Similar Products

Product Notes

The GOSR2 gosr2 (Catalog #AAA3240355) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GOSR2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOSR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOSR2 gosr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASIDQIFSRL ERLEILSSKE PPNKRQNARL RVDQLKYDVQ HLQTALRNFQ. It is sometimes possible for the material contained within the vial of "GOSR2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.