Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FZD10 blocking peptide

FZD10 Peptide - C-terminal region

Gene Names
FZD10; Fz10; FzE7; CD350; FZ-10; hFz10
Reactivity
Human
Applications
Western Blot
Synonyms
FZD10; FZD10 Peptide - C-terminal region; FZD10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Sequence Length
581
Applicable Applications for FZD10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FZD10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FZD10 Antibody, made

Target Description: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Product Categories/Family for FZD10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
frizzled-10
NCBI Official Synonym Full Names
frizzled class receptor 10
NCBI Official Symbol
FZD10
NCBI Official Synonym Symbols
Fz10; FzE7; CD350; FZ-10; hFz10
NCBI Protein Information
frizzled-10
UniProt Protein Name
Frizzled-10
Protein Family
UniProt Gene Name
FZD10
UniProt Synonym Gene Names
Fz-10; hFz10
UniProt Entry Name
FZD10_HUMAN

NCBI Description

This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

FZD10: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, Fz/Smo family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.33

Cellular Component: cell surface; integral to plasma membrane; cytoplasm

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; protein binding

Biological Process: neuron differentiation; G-protein coupled receptor protein signaling pathway; positive regulation of JNK activity; regulation of actin cytoskeleton organization and biogenesis; Wnt receptor signaling pathway through beta-catenin

Research Articles on FZD10

Similar Products

Product Notes

The FZD10 fzd10 (Catalog #AAA3230705) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FZD10 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FZD10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FZD10 fzd10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH. It is sometimes possible for the material contained within the vial of "FZD10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.