Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FUZ blocking peptide

FUZ Peptide - C-terminal region

Reactivity
Human
Applications
Western Blot
Synonyms
FUZ; FUZ Peptide - C-terminal region; FUZ blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RCLFTVEPLGDKEPSPEQRRRLLRNFYTLVTSTHFPPEPGPPEKTEDEVY
Sequence Length
382
Applicable Applications for FUZ blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FUZ blocking peptide
This is a synthetic peptide designed for use in combination with anti-FUZ Antibody, made

Target Description: FUZ is a probable planar cell polarity effector involved in cilium biogenesis. FUZ may regulate protein and membrane transport to the cilium and may regulate the morphogenesis of hair follicles which depends on functional primary cilia.
Product Categories/Family for FUZ blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
protein fuzzy homolog isoform 2
UniProt Protein Name
Protein fuzzy homolog
Protein Family
UniProt Gene Name
FUZ
UniProt Synonym Gene Names
FY
UniProt Entry Name
FUZZY_HUMAN

Uniprot Description

FUZ: Probable planar cell polarity effector involved in cilium biogenesis. May regulate protein and membrane transport to the cilium. May regulate the morphogenesis of hair follicles which depends on functional primary cilia. Belongs to the fuzzy family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: cytoskeleton; cytoplasm

Biological Process: spinal cord dorsal/ventral patterning; embryonic skeletal morphogenesis; negative regulation of cell proliferation; embryonic body morphogenesis; protein transport; hair follicle development; sensory cilium biogenesis; neural tube closure; cilium biogenesis; establishment of planar polarity; negative regulation of cell migration; positive regulation of flagellum biogenesis; regulation of smoothened signaling pathway

Disease: Neural Tube Defects

Similar Products

Product Notes

The FUZ fuz (Catalog #AAA3241545) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FUZ Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FUZ fuz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RCLFTVEPLG DKEPSPEQRR RLLRNFYTLV TSTHFPPEPG PPEKTEDEVY. It is sometimes possible for the material contained within the vial of "FUZ, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.