Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FKBP1B blocking peptide

FKBP1B Peptide - middle region

Gene Names
FKBP1B; OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
Reactivity
Human
Synonyms
FKBP1B; FKBP1B Peptide - middle region; FKBP1B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQ
Sequence Length
108
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FKBP1B blocking peptide
This is a synthetic peptide designed for use in combination with anti- FKBP1B Antibody, made

Target Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Product Categories/Family for FKBP1B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11 kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1B isoform a
NCBI Official Synonym Full Names
FKBP prolyl isomerase 1B
NCBI Official Symbol
FKBP1B
NCBI Official Synonym Symbols
OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1B
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1B
UniProt Gene Name
FKBP1B
UniProt Synonym Gene Names
FKBP12.6; FKBP1L; FKBP9; OTK4; PPIase FKBP1B; 12.6 kDa FKBP; FKBP-12.6; FKBP-1B
UniProt Entry Name
FKB1B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

FKBP1B: Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Belongs to the FKBP-type PPIase family. FKBP1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Isomerase; EC 5.2.1.8

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: sarcoplasmic reticulum membrane; membrane; cytoplasm; Z disc; cytosol

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; FK506 binding; cyclic nucleotide binding; calcium channel inhibitor activity; ryanodine-sensitive calcium-release channel activity; receptor binding

Biological Process: positive regulation of sequestering of calcium ion; positive regulation of axon regeneration; protein maturation via protein folding; protein peptidyl-prolyl isomerization; cytosolic calcium ion homeostasis; negative regulation of heart rate; response to redox state; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; T cell proliferation; negative regulation of protein phosphatase type 2B activity; response to vitamin E; smooth muscle contraction; 'de novo' protein folding; response to hydrogen peroxide; insulin secretion; negative regulation of release of sequestered calcium ion into cytosol; action potential propagation; response to glucose stimulus; protein refolding; transmembrane transport

Research Articles on FKBP1B

Similar Products

Product Notes

The FKBP1B fkbp1b (Catalog #AAA3247396) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FKBP1B Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: IETISPGDGR TFPKKGQTCV VHYTGMLQNG KKFDSSRDRN KPFKFRIGKQ. It is sometimes possible for the material contained within the vial of "FKBP1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.