Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FCGR3A blocking peptide

FCGR3A Peptide - middle region

Gene Names
FCGR3A; CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
Reactivity
Human
Applications
Western Blot
Synonyms
FCGR3A; FCGR3A Peptide - middle region; FCGR3A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF
Sequence Length
253
Applicable Applications for FCGR3A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FCGR3A blocking peptide
This is a synthetic peptide designed for use in combination with anti-FCGR3A Antibody, made

Target Description: This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for FCGR3A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor III-A isoform d
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIIa
NCBI Official Symbol
FCGR3A
NCBI Official Synonym Symbols
CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor III-A
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor III-A
UniProt Gene Name
FCGR3A
UniProt Synonym Gene Names
CD16A; FCG3; FCGR3; IGFR3; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa
UniProt Entry Name
FCG3A_HUMAN

NCBI Description

This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR3A: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: IgG binding

Biological Process: regulation of immune response; innate immune response; immune response

Disease: Immunodeficiency 20

Research Articles on FCGR3A

Similar Products

Product Notes

The FCGR3A fcgr3a (Catalog #AAA3240982) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FCGR3A Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCGR3A fcgr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DPIHLRCHSW KNTALHKVTY LQNGKGRKYF HHNSDFYIPK ATLKDSGSYF. It is sometimes possible for the material contained within the vial of "FCGR3A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.