Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FBXO6 blocking peptide

FBXO6 Peptide - N-terminal region

Gene Names
FBXO6; FBG2; FBS2; FBX6; Fbx6b
Reactivity
Human
Applications
Western Blot
Synonyms
FBXO6; FBXO6 Peptide - N-terminal region; FBXO6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: HSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLW
Sequence Length
255
Applicable Applications for FBXO6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FBXO6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FBXO6 Antibody, made

Target Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle.
Product Categories/Family for FBXO6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
F-box only protein 6
NCBI Official Synonym Full Names
F-box protein 6
NCBI Official Symbol
FBXO6
NCBI Official Synonym Symbols
FBG2; FBS2; FBX6; Fbx6b
NCBI Protein Information
F-box only protein 6
UniProt Protein Name
F-box only protein 44
UniProt Gene Name
FBXO44
UniProt Synonym Gene Names
FBG3; FBX30; FBX44; FBX6A; FBXO6A
UniProt Entry Name
FBX44_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXO44: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: SCF ubiquitin ligase complex

Molecular Function: protein binding

Research Articles on FBXO6

Similar Products

Product Notes

The FBXO6 fbxo44 (Catalog #AAA3245735) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FBXO6 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXO6 fbxo44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HSKAALDSIN ELPENILLEL FTHVPARQLL LNCRLVCSLW RDLIDLMTLW. It is sometimes possible for the material contained within the vial of "FBXO6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.