Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FBXL20 blocking peptide

FBXL20 Peptide - middle region

Gene Names
FBXL20; Fbl2; Fbl20
Reactivity
Human
Applications
Western Blot
Synonyms
FBXL20; FBXL20 Peptide - middle region; FBXL20 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVT
Sequence Length
436
Applicable Applications for FBXL20 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FBXL20 blocking peptide
This is a synthetic peptide designed for use in combination with anti-FBXL20 Antibody, made

Target Description: Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains
Product Categories/Family for FBXL20 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
F-box/LRR-repeat protein 20 isoform 1
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 20
NCBI Official Symbol
FBXL20
NCBI Official Synonym Symbols
Fbl2; Fbl20
NCBI Protein Information
F-box/LRR-repeat protein 20
UniProt Protein Name
F-box/LRR-repeat protein 20
Protein Family
UniProt Gene Name
FBXL20
UniProt Synonym Gene Names
FBL2
UniProt Entry Name
FXL20_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Uniprot Description

FBXL20: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. Role in neural transmission. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: cytoplasm

Biological Process: behavioral fear response

Research Articles on FBXL20

Similar Products

Product Notes

The FBXL20 fbxl20 (Catalog #AAA3239843) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FBXL20 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXL20 fbxl20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ISWCDQVTKD GIQALVRGCG GLKALFLKGC TQLEDEALKY IGAHCPELVT. It is sometimes possible for the material contained within the vial of "FBXL20, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.