Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FAP blocking peptide

FAP Peptide - C-terminal region

Gene Names
FAP; FAPA; SIMP; DPPIV; FAPalpha
Reactivity
Human
Applications
Western Blot
Synonyms
FAP; FAP Peptide - C-terminal region; FAP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA
Sequence Length
239
Applicable Applications for FAP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FAP blocking peptide
This is a synthetic peptide designed for use in combination with anti-FAP Antibody, made

Target Description: The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis.
Product Categories/Family for FAP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
prolyl endopeptidase FAP isoform 1
NCBI Official Synonym Full Names
fibroblast activation protein alpha
NCBI Official Symbol
FAP
NCBI Official Synonym Symbols
FAPA; SIMP; DPPIV; FAPalpha
NCBI Protein Information
prolyl endopeptidase FAP
UniProt Protein Name
Seprase
Protein Family
UniProt Gene Name
FAP
UniProt Entry Name
SEPR_HUMAN

NCBI Description

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

FAP: In association with DPP4 is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May have a role in tissue remodeling during development and wound healing, and may contribute to invasiveness in malignant cancers. Belongs to the peptidase S9B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.14.5; Protease; EC 3.4.21.26; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q23

Cellular Component: extracellular space; focal adhesion; cell surface; lamellipodium; apical part of cell; cytoplasm; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein dimerization activity; peptidase activity; protein binding; protein homodimerization activity; protease binding; dipeptidyl-peptidase activity; serine-type peptidase activity; metalloendopeptidase activity; serine-type endopeptidase activity; endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process; endothelial cell migration; angiogenesis; proteolysis; cell adhesion; regulation of fibrinolysis

Research Articles on FAP

Similar Products

Product Notes

The FAP fap (Catalog #AAA3233182) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FAP Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAP fap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWEYYASVYT ERFMGLPTKD DNLEHYKNST VMARAEYFRN VDYLLIHGTA. It is sometimes possible for the material contained within the vial of "FAP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.