Rabbit FAP Polyclonal Antibody | anti-FAP antibody

FAP Antibody - C-terminal region

Cat. Num. AAA3208219

• Gene Names: FAP; FAPA; SIMP; DPPIV; FAPalpha
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: FAP; Polyclonal Antibody; FAP Antibody - C-terminal region; anti-FAP antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA
• Sequence Length: 239

• Applicable Applications for anti-FAP antibody: Western Blot (WB)
• Homology: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FAPSample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-FAP antibody

This is a rabbit polyclonal antibody against FAP. It was validated on Western Blot

Target Description: The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis.

Product Categories/Family for anti-FAP antibody

Polyclonal; Cancer; Membrane Protein; Developmental Biology; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 16933540
• NCBI GeneID: 2191
• NCBI Accession #: NP_004451
• NCBI GenBank Nucleotide #: NM_004460
• UniProt Accession #: Q12884
• Molecular Weight: 26kDa
• NCBI Official Full Name: prolyl endopeptidase FAP isoform 1
• NCBI Official Synonym Full Names: fibroblast activation protein alpha
• NCBI Official Symbol: FAP
• NCBI Official Synonym Symbols: FAPA; SIMP; DPPIV; FAPalpha
• NCBI Protein Information: prolyl endopeptidase FAP
• UniProt Protein Name: Seprase
• Protein Family: Fap1 adhesin
• UniProt Gene Name: FAP
• UniProt Entry Name: SEPR_HUMAN

NCBI Description

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

FAP: In association with DPP4 is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May have a role in tissue remodeling during development and wound healing, and may contribute to invasiveness in malignant cancers. Belongs to the peptidase S9B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.14.5; Protease; EC 3.4.21.26; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q23

Cellular Component: extracellular space; focal adhesion; cell surface; lamellipodium; apical part of cell; cytoplasm; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein dimerization activity; peptidase activity; protein binding; protein homodimerization activity; protease binding; dipeptidyl-peptidase activity; serine-type peptidase activity; metalloendopeptidase activity; serine-type endopeptidase activity; endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process; endothelial cell migration; angiogenesis; proteolysis; cell adhesion; regulation of fibrinolysis