Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FAIM2 blocking peptide

FAIM2 Peptide - middle region

Gene Names
FAIM2; LFG; LFG2; NGP35; NMP35; TMBIM2
Reactivity
Human
Synonyms
FAIM2; FAIM2 Peptide - middle region; FAIM2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTF
Sequence Length
316
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FAIM2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- FAIM2 Antibody, made

Target Description: Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.
Product Categories/Family for FAIM2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
protein lifeguard 2
NCBI Official Synonym Full Names
Fas apoptotic inhibitory molecule 2
NCBI Official Symbol
FAIM2
NCBI Official Synonym Symbols
LFG; LFG2; NGP35; NMP35; TMBIM2
NCBI Protein Information
protein lifeguard 2
UniProt Protein Name
Protein lifeguard 2
Protein Family
UniProt Gene Name
FAIM2
UniProt Synonym Gene Names
KIAA0950; LFG; LFG2; NMP35; TMBIM2
UniProt Entry Name
LFG2_HUMAN

Uniprot Description

FAIM2: Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development. Belongs to the BI1 family. LFG subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Apoptosis

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: postsynaptic membrane; integral to membrane; cell junction; lipid raft

Biological Process: apoptosis; cerebellar granular layer development; regulation of neuron apoptosis; cerebellar Purkinje cell differentiation; cerebellar Purkinje cell layer development; cerebellum development; negative regulation of neuron apoptosis; negative regulation of apoptosis

Research Articles on FAIM2

Similar Products

Product Notes

The FAIM2 faim2 (Catalog #AAA3247153) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FAIM2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSGEGMKAGA FPPAPTAVPL HPSWAYVDPS SSSSYDNGFP TGDHELFTTF. It is sometimes possible for the material contained within the vial of "FAIM2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.