Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EPS8L2 blocking peptide

EPS8L2 Peptide - middle region

Gene Names
EPS8L2; EPS8R2; DFNB106
Reactivity
Human
Synonyms
EPS8L2; EPS8L2 Peptide - middle region; EPS8L2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPVSSPHTHRGYQPTPAMA
Sequence Length
715
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EPS8L2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- EPS8L2 Antibody, made

Target Description: This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling.
Product Categories/Family for EPS8L2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78 kDa
NCBI Official Full Name
epidermal growth factor receptor kinase substrate 8-like protein 2
NCBI Official Synonym Full Names
EPS8 like 2
NCBI Official Symbol
EPS8L2
NCBI Official Synonym Symbols
EPS8R2; DFNB106
NCBI Protein Information
epidermal growth factor receptor kinase substrate 8-like protein 2
UniProt Protein Name
Epidermal growth factor receptor kinase substrate 8-like protein 2
UniProt Gene Name
EPS8L2
UniProt Synonym Gene Names
EPS8R2; EPS8-like protein 2
UniProt Entry Name
ES8L2_HUMAN

NCBI Description

This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq, Dec 2008]

Uniprot Description

EPS8L2: Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton. Belongs to the EPS8 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rac/Rho; Actin-binding

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: protein complex; cytoplasm; plasma membrane; vesicle

Molecular Function: Rho guanyl-nucleotide exchange factor activity; Rac guanyl-nucleotide exchange factor activity; actin binding

Biological Process: regulation of Rho protein signal transduction; Rho protein signal transduction

Research Articles on EPS8L2

Similar Products

Product Notes

The EPS8L2 eps8l2 (Catalog #AAA3246844) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EPS8L2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEEVSPVSRQ SIRNSQKHSP TSEPTPPGDA LPPVSSPHTH RGYQPTPAMA. It is sometimes possible for the material contained within the vial of "EPS8L2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.