EPS8L1 blocking peptide
EPS8L1 Peptide - C-terminal region
Reactivity
Human
Synonyms
EPS8L1; EPS8L1 Peptide - C-terminal region; EPS8L1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GRSAWPRLTRLSYFLQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCN
Sequence Length
551
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EPS8L1 blocking peptide
This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for EPS8L1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
UniProt Protein Name
Epidermal growth factor receptor kinase substrate 8-like protein 1
UniProt Gene Name
EPS8L1
UniProt Synonym Gene Names
DRC3; EPS8R1; EPS8-like protein 1
UniProt Entry Name
ES8L1_HUMAN
Uniprot Description
EPS8L1: Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton. Belongs to the EPS8 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 19q13.42
Cellular Component: protein complex; cytoplasm
Molecular Function: protein binding; Rho guanyl-nucleotide exchange factor activity; Rac guanyl-nucleotide exchange factor activity; T cell receptor binding; actin binding
Biological Process: regulation of Rho protein signal transduction; Rho protein signal transduction
Similar Products
Product Notes
The EPS8L1 eps8l1 (Catalog #AAA3231481) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EPS8L1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRSAWPRLTR LSYFLQQSAP QVAVNGHRDL EPESEPQLES ETAGKWVLCN. It is sometimes possible for the material contained within the vial of "EPS8L1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
