Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EPHA2 blocking peptide

EPHA2 Peptide - N-terminal region

Gene Names
EPHA2; ECK; CTPA; ARCC2; CTPP1; CTRCT6
Reactivity
Human
Synonyms
EPHA2; EPHA2 Peptide - N-terminal region; EPHA2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCK
Sequence Length
976
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EPHA2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- EPHA2 Antibody, made

Target Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Mutations in this gene are the cause of certain genetically-related cataract disorders.
Product Categories/Family for EPHA2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
ephrin type-A receptor 2 isoform 1
NCBI Official Synonym Full Names
EPH receptor A2
NCBI Official Symbol
EPHA2
NCBI Official Synonym Symbols
ECK; CTPA; ARCC2; CTPP1; CTRCT6
NCBI Protein Information
ephrin type-A receptor 2
UniProt Protein Name
Ephrin type-A receptor 2
Protein Family
UniProt Gene Name
EPHA2
UniProt Synonym Gene Names
ECK
UniProt Entry Name
EPHA2_HUMAN

NCBI Description

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Mutations in this gene are the cause of certain genetically-related cataract disorders.[provided by RefSeq, May 2010]

Uniprot Description

EphA2: a receptor tyrosine kinase. Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A3, -A4 AND -A5. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. Overexpressed in many cancers including aggressive ovarian, cervical and breast carcinomas, and lung cancer. Expression correlates with degree of angiogenesis, metastasis and xenograft tumor growth. Soluble receptor inhibits tumor growth and angiogenesis in mice.

Protein type: Kinase, protein; Membrane protein, integral; EC 2.7.10.1; Protein kinase, tyrosine (receptor); Protein kinase, TK; TK group; Eph family

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: cell surface; focal adhesion; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; ephrin receptor activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: neural tube development; axon guidance; peptidyl-tyrosine phosphorylation; viral reproduction; multicellular organismal development; notochord formation; osteoclast differentiation; bone remodeling; regulation of blood vessel endothelial cell migration; regulation of cell adhesion mediated by integrin; protein kinase B signaling cascade; ephrin receptor signaling pathway; angiogenesis; cell adhesion; vasculogenesis; skeletal development; axial mesoderm formation; cell migration; negative regulation of protein kinase B signaling cascade; mammary gland epithelial cell proliferation; regulation of angiogenesis; keratinocyte differentiation; osteoblast differentiation; DNA damage response, signal transduction resulting in induction of apoptosis; notochord cell development

Disease: Cataract 6, Multiple Types

Research Articles on EPHA2

Similar Products

Product Notes

The EPHA2 epha2 (Catalog #AAA3246995) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EPHA2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSVCNVMSGD QDNWLRTNWV YRGEAERIFI ELKFTVRDCN SFPGGASSCK. It is sometimes possible for the material contained within the vial of "EPHA2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.