Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EIF4EBP1 blocking peptide

EIF4EBP1 Peptide - C-terminal region

Gene Names
EIF4EBP1; BP-1; 4EBP1; 4E-BP1; PHAS-I
Reactivity
Human
Synonyms
EIF4EBP1; EIF4EBP1 Peptide - C-terminal region; EIF4EBP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQ
Sequence Length
118
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EIF4EBP1 blocking peptide
This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.
Product Categories/Family for EIF4EBP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4E-binding protein 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E binding protein 1
NCBI Official Symbol
EIF4EBP1
NCBI Official Synonym Symbols
BP-1; 4EBP1; 4E-BP1; PHAS-I
NCBI Protein Information
eukaryotic translation initiation factor 4E-binding protein 1
UniProt Protein Name
Eukaryotic translation initiation factor 4E-binding protein 1
UniProt Gene Name
EIF4EBP1
UniProt Synonym Gene Names
4E-BP1; eIF4E-binding protein 1; PHAS-I
UniProt Entry Name
4EBP1_HUMAN

NCBI Description

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq, Jul 2008]

Uniprot Description

4E-BP1: binds to eIF4E, preventing its assembly into the EIF4F complex and inhibiting cap-dependent translation. Phosphorylation of 4E-BP1 disrupts this binding, activating cap-dependent translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the PI3 kinase pathway.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: nucleoplasm; protein complex; cytoplasm; cytosol

Molecular Function: protein binding; translation repressor activity; eukaryotic initiation factor 4E binding

Biological Process: negative regulation of translational initiation; response to ethanol; cellular protein metabolic process; TOR signaling pathway; translation; insulin receptor signaling pathway; translational initiation; gene expression; positive regulation of mitotic cell cycle; negative regulation of protein complex assembly; G1/S transition of mitotic cell cycle; lung development

Research Articles on EIF4EBP1

Similar Products

Product Notes

The EIF4EBP1 eif4ebp1 (Catalog #AAA3244582) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EIF4EBP1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSPVTKTPPR DLPTIPGVTS PSSDEPPMEA SQSHLRNSPE DKRAGGEESQ. It is sometimes possible for the material contained within the vial of "EIF4EBP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.