Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DDX19B blocking peptide

DDX19B Peptide - N-terminal region

Gene Names
DDX19B; DBP5; RNAh; DDX19
Reactivity
Human
Applications
Western Blot
Synonyms
DDX19B; DDX19B Peptide - N-terminal region; DDX19B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: WALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKED
Sequence Length
479
Applicable Applications for DDX19B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DDX19B blocking peptide
This is a synthetic peptide designed for use in combination with anti-DDX19B Antibody, made

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for DDX19B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX19B isoform 3
NCBI Official Synonym Full Names
DEAD-box helicase 19B
NCBI Official Symbol
DDX19B
NCBI Official Synonym Symbols
DBP5; RNAh; DDX19
NCBI Protein Information
ATP-dependent RNA helicase DDX19B
UniProt Protein Name
ATP-dependent RNA helicase DDX19B
UniProt Gene Name
DDX19B
UniProt Synonym Gene Names
DBP5; DDX19; TDBP
UniProt Entry Name
DD19B_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DDX19B: ATP-dependent RNA helicase involved in mRNA export from the nucleus. Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nuclear membrane; membrane; cytoplasm; nuclear envelope; nuclear pore

Molecular Function: RNA binding; helicase activity; ATP binding

Biological Process: mRNA export from nucleus; protein transport

Research Articles on DDX19B

Similar Products

Product Notes

The DDX19B ddx19b (Catalog #AAA3245369) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DDX19B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX19B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX19B ddx19b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WALAVDEQEA AAESLSNLHL KEEKIKPDTN GAVVKTNANA EKTDEEEKED. It is sometimes possible for the material contained within the vial of "DDX19B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.