DDX10 blocking peptide
DDX10 Antibody-C-terminal region
Reactivity
Human
Synonyms
DDX10; DDX10 Antibody-C-terminal region; HRH-J8; DDX10 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
875 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DDX10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DDX10 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies.
Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies.
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
96kDa
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX10
Protein Family
UniProt Gene Name
DDX10
Uniprot Description
DDX10: Putative ATP-dependent RNA helicase. Belongs to the DEAD box helicase family. DDX10/DBP4 subfamily.
Protein type: EC 3.6.4.13; Helicase; RNA-binding
Chromosomal Location of Human Ortholog: 11q22.3
Cellular Component: cytoplasm; nucleolus
Molecular Function: ATP binding; ATP-dependent RNA helicase activity; RNA binding; RNA helicase activity
Biological Process: RNA secondary structure unwinding
Similar Products
Product Notes
The DDX10 ddx10 (Catalog #AAA3249301) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DDX10 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: EANKRQAKAK DEEEAFLDWS DDDDDDDDGF DPSTLPDPDK YRSSEDSDSE. It is sometimes possible for the material contained within the vial of "DDX10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
