Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DCC blocking peptide

DCC Peptide - middle region

Gene Names
DCC; CRC18; CRCR1; MRMV1; HGPPS2; IGDCC1; NTN1R1
Reactivity
Human
Applications
Western Blot
Synonyms
DCC; DCC Peptide - middle region; DCC blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
Sequence Length
1447
Applicable Applications for DCC blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DCC blocking peptide
This is a synthetic peptide designed for use in combination with anti-DCC Antibody, made

Target Description: This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.
Product Categories/Family for DCC blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
158kDa
NCBI Official Full Name
netrin receptor DCC
NCBI Official Synonym Full Names
DCC netrin 1 receptor
NCBI Official Symbol
DCC
NCBI Official Synonym Symbols
CRC18; CRCR1; MRMV1; HGPPS2; IGDCC1; NTN1R1
NCBI Protein Information
netrin receptor DCC
UniProt Protein Name
Netrin receptor DCC
Protein Family
UniProt Gene Name
DCC
UniProt Synonym Gene Names
IGDCC1
UniProt Entry Name
DCC_HUMAN

NCBI Description

This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma. [provided by RefSeq, Oct 2009]

Uniprot Description

DCC: Receptor for netrin required for axon guidance. Mediates axon attraction of neuronal growth cones in the developing nervous system upon ligand binding. Its association with UNC5 proteins may trigger signaling for axon repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Implicated as a tumor suppressor gene. Defects in DCC are the cause of mirror movements type 1 (MRMV1). A disorder characterized by contralateral involuntary movements that mirror voluntary ones. While mirror movements are occasionally found in young children, persistence beyond the age of 10 is abnormal. Mirror movements occur more commonly in the upper extremities. Belongs to the immunoglobulin superfamily. DCC family.

Protein type: Membrane protein, integral; Immunoglobulin superfamily; Tumor suppressor; Receptor, misc.

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: axon; integral to membrane; plasma membrane; cytosol; lipid raft

Molecular Function: identical protein binding; protein binding; transmembrane receptor activity; netrin receptor activity; transcription coactivator activity

Biological Process: axon guidance; axonogenesis; spinal cord ventral commissure morphogenesis; positive regulation of apoptosis; apoptosis; response to amphetamine; neuron migration; negative regulation of collateral sprouting; dorsal/ventral axon guidance; anterior/posterior axon guidance

Disease: Mirror Movements 1; Esophageal Cancer; Colorectal Cancer

Research Articles on DCC

Similar Products

Product Notes

The DCC dcc (Catalog #AAA3233216) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DCC Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCC dcc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PIGQMHPPHG SVTPQKNSNL LVIIVVTVGV ITVLVVVIVA VICTRRSSAQ. It is sometimes possible for the material contained within the vial of "DCC, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.