DCAF7 blocking peptide

DCAF7 Peptide - N-terminal region

Cat. Num. AAA3235569

• Gene Names: DCAF7; AN11; HAN11; WDR68; SWAN-1
• Reactivity: Human
• Applications: Western Blot
• Synonyms: DCAF7; DCAF7 Peptide - N-terminal region; DCAF7 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLEC
• Sequence Length: 342

• Applicable Applications for DCAF7 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for DCAF7 blocking peptide

This is a synthetic peptide designed for use in combination with anti-DCAF7 Antibody, made

Target Description: This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants.

Product Categories/Family for DCAF7 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 108936958
• NCBI GeneID: 10238
• NCBI Accession #: NP_005819
• NCBI GenBank Nucleotide #: NM_005828.5
• UniProt Accession #: P61962
• Molecular Weight: 37kDa
• NCBI Official Full Name: DDB1- and CUL4-associated factor 7
• NCBI Official Synonym Full Names: DDB1 and CUL4 associated factor 7
• NCBI Official Symbol: DCAF7
• NCBI Official Synonym Symbols: AN11; HAN11; WDR68; SWAN-1
• NCBI Protein Information: DDB1- and CUL4-associated factor 7
• UniProt Protein Name: DDB1- and CUL4-associated factor 7
• Protein Family: DDB1- and CUL4-associated factor
• UniProt Gene Name: DCAF7
• UniProt Synonym Gene Names: HAN11; WDR68
• UniProt Entry Name: DCAF7_HUMAN

NCBI Description

This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

WDR68: a WD40 repeat protein. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; nuclear matrix; protein complex; cytoplasm

Molecular Function: protein binding

Biological Process: multicellular organismal development; protein ubiquitination