Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DAB1 blocking peptide

DAB1 Peptide - N-terminal region

Gene Names
DAB1; SCA37
Reactivity
Human
Synonyms
DAB1; DAB1 Peptide - N-terminal region; DAB1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQD
Sequence Length
213
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DAB1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- DAB1 Antibody, made

Target Description: The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Product Categories/Family for DAB1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
disabled homolog 1 isoform 1
NCBI Official Synonym Full Names
DAB adaptor protein 1
NCBI Official Symbol
DAB1
NCBI Official Synonym Symbols
SCA37
NCBI Protein Information
disabled homolog 1
UniProt Protein Name
Disabled homolog 1
Protein Family
UniProt Gene Name
DAB1
UniProt Entry Name
DAB1_HUMAN

NCBI Description

The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. [provided by RefSeq, Jan 2017]

Uniprot Description

DAB1: an adaptor molecule functioning in neural development. The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. Thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. Associates with the SH2 domains of Src, Fyn and Abl. Phosphorylated in response to reelin induction in embryonic neurons

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p32-p31

Cellular Component: neuron projection; cell soma; membrane; apical part of cell; perinuclear region of cytoplasm; postsynaptic density; cytosol; brush border

Molecular Function: phosphoinositide 3-kinase binding

Biological Process: cell-cell adhesion involved in neuronal-glial interactions involved in cerebral cortex radial glia guided migration; response to drug; Golgi localization; cerebellum structural organization; ventral spinal cord development; negative regulation of cell adhesion; adult walking behavior; small GTPase mediated signal transduction; radial glia guided migration of Purkinje cell; positive regulation of protein kinase activity; negative regulation of astrocyte differentiation; dendrite development; midgut development; negative regulation of axonogenesis; cerebral cortex radially oriented cell migration; positive regulation of neuron differentiation; negative regulation of JAK-STAT cascade

Research Articles on DAB1

Similar Products

Product Notes

The DAB1 dab1 (Catalog #AAA3247021) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DAB1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAKKDSRKKG QDRSEATLIK RFKGEGVRYK AKLIGIDEVS AARGDKLCQD. It is sometimes possible for the material contained within the vial of "DAB1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.