Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CYP21A2 blocking peptide

CYP21A2 Peptide - C-terminal region

Gene Names
CYP21A2; CAH1; CPS1; CA21H; CYP21; CYP21B; P450c21B
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
CYP21A2; CYP21A2 Peptide - C-terminal region; CYP21A2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
Sequence Length
495
Applicable Applications for CYP21A2 blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CYP21A2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CYP21A2 Antibody, made

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CYP21A2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
steroid 21-hydroxylase isoform a
NCBI Official Synonym Full Names
cytochrome P450 family 21 subfamily A member 2
NCBI Official Symbol
CYP21A2
NCBI Official Synonym Symbols
CAH1; CPS1; CA21H; CYP21; CYP21B; P450c21B
NCBI Protein Information
steroid 21-hydroxylase
UniProt Protein Name
Cytochrome P450 21-hydroxylase
UniProt Gene Name
P450-CYP21B
UniProt Synonym Gene Names
CYP21A2
UniProt Entry Name
Q16874_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP21A2: Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids. Defects in CYP21A2 are the cause of adrenal hyperplasia type 3 (AH3). AH3 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: 'salt wasting' (SW, the most severe type), 'simple virilizing' (SV, less severely affected patients), with normal aldosterone biosynthesis, 'non-classic form' or late onset (NC or LOAH), and 'cryptic' (asymptomatic). Belongs to the cytochrome P450 family.

Protein type: Lipid Metabolism - C21-steroid hormone; EC 1.14.99.10; Oxidoreductase

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: endoplasmic reticulum membrane

Molecular Function: steroid 21-monooxygenase activity; iron ion binding; heme binding; steroid hydroxylase activity; steroid binding

Biological Process: steroid metabolic process; xenobiotic metabolic process; mineralocorticoid biosynthetic process; glucocorticoid biosynthetic process; sterol metabolic process

Disease: Adrenal Hyperplasia, Congenital, Due To 21-hydroxylase Deficiency

Research Articles on CYP21A2

Similar Products

Product Notes

The CYP21A2 p450-cyp21b (Catalog #AAA3239615) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CYP21A2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP21A2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CYP21A2 p450-cyp21b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IQQRLQEELD HELGPGASSS RVPYKDRARL PLLNATIAEV LRLRPVVPLA. It is sometimes possible for the material contained within the vial of "CYP21A2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.