Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTSL1 blocking peptide

CTSL1 Peptide - C-terminal region

Gene Names
CTSL; MEP; CATL; CTSL1
Reactivity
Human
Applications
Western Blot
Synonyms
CTSL1; CTSL1 Peptide - C-terminal region; CTSL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVG
Sequence Length
333
Applicable Applications for CTSL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTSL1 blocking peptide
The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for CTSL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
cathepsin L1 isoform 1 preproprotein
NCBI Official Synonym Full Names
cathepsin L
NCBI Official Symbol
CTSL
NCBI Official Synonym Symbols
MEP; CATL; CTSL1
NCBI Protein Information
cathepsin L1
UniProt Protein Name
Cathepsin L1
UniProt Gene Name
CTSL1
UniProt Synonym Gene Names
CTSL; MEP
UniProt Entry Name
CATL1_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

CTSL1: Important for the overall degradation of proteins in lysosomes. Belongs to the peptidase C1 family.

Protein type: Motility/polarity/chemotaxis; EC 3.4.22.15; Protease

Chromosomal Location of Human Ortholog: 9q21.33

Cellular Component: extracellular space; lysosomal lumen; lysosome; extracellular region; nucleus

Molecular Function: collagen binding; protein binding; proteoglycan binding; histone binding; fibronectin binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: antigen processing and presentation; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; adaptive immune response; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis

Research Articles on CTSL1

Similar Products

Product Notes

The CTSL1 ctsl1 (Catalog #AAA3240837) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTSL1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTSL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTSL1 ctsl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGLDSEESYP YEATEESCKY NPKYSVANDT GFVDIPKQEK ALMKAVATVG. It is sometimes possible for the material contained within the vial of "CTSL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.