CTDSP2 blocking peptide
CTDSP2 Peptide - middle region
Gene Names
CTDSP2; OS4; PSR2; SCP2
Reactivity
Human
Applications
Western Blot
Synonyms
CTDSP2; CTDSP2 Peptide - middle region; CTDSP2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA
Sequence Length
271
Applicable Applications for CTDSP2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTDSP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CTDSP2 Antibody, made
Target Description: CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.CTDSP2 negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. CTDSP2 is recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.CTDSP2 may contribute to the development of sarcomas.
Target Description: CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.CTDSP2 negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. CTDSP2 is recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.CTDSP2 may contribute to the development of sarcomas.
Product Categories/Family for CTDSP2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
NCBI Official Synonym Full Names
CTD small phosphatase 2
NCBI Official Symbol
CTDSP2
NCBI Official Synonym Symbols
OS4; PSR2; SCP2
NCBI Protein Information
carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
UniProt Protein Name
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
UniProt Gene Name
CTDSP2
UniProt Synonym Gene Names
NIF2; OS4; SCP2; NLI-interacting factor 2; SCP2
UniProt Entry Name
CTDS2_HUMAN
Research Articles on CTDSP2
Similar Products
Product Notes
The CTDSP2 ctdsp2 (Catalog #AAA3235558) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTDSP2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTDSP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTDSP2 ctdsp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASYIFHPENA VPVQSWFDDM ADTELLNLIP IFEELSGAED VYTSLGQLRA. It is sometimes possible for the material contained within the vial of "CTDSP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
