Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CSF3R blocking peptide

CSF3R Peptide - N-terminal region

Gene Names
CSF3R; SCN7; CD114; GCSFR
Reactivity
Human
Applications
Western Blot
Synonyms
CSF3R; CSF3R Peptide - N-terminal region; CSF3R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: HNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD
Sequence Length
836
Applicable Applications for CSF3R blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CSF3R blocking peptide
This is a synthetic peptide designed for use in combination with anti-CSF3R Antibody, made

Target Description: The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Product Categories/Family for CSF3R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
granulocyte colony-stimulating factor receptor isoform d
NCBI Official Synonym Full Names
colony stimulating factor 3 receptor
NCBI Official Symbol
CSF3R
NCBI Official Synonym Symbols
SCN7; CD114; GCSFR
NCBI Protein Information
granulocyte colony-stimulating factor receptor
UniProt Protein Name
Granulocyte colony-stimulating factor receptor
UniProt Gene Name
CSF3R
UniProt Synonym Gene Names
GCSFR; G-CSF receptor; G-CSF-R
UniProt Entry Name
CSF3R_HUMAN

NCBI Description

The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq, Aug 2010]

Uniprot Description

GCSFR: the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Four transcript variant isoforms have been described.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p35-p34.3

Cellular Component: integral to plasma membrane; extracellular region

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; receptor activity

Biological Process: neutrophil chemotaxis; cytokine and chemokine mediated signaling pathway; defense response; signal transduction; cell adhesion

Disease: Neutrophilia, Hereditary

Research Articles on CSF3R

Similar Products

Product Notes

The CSF3R csf3r (Catalog #AAA3226737) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CSF3R Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSF3R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSF3R csf3r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HNLSCLMNLT TSSLICQWEP GPETHLPTSF TLKSFKSRGN CQTQGDSILD. It is sometimes possible for the material contained within the vial of "CSF3R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.