Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CRP blocking peptide

CRP Peptide - N-terminal region

Gene Names
CRP; PTX1
Reactivity
Human
Applications
Western Blot
Synonyms
CRP; CRP Peptide - N-terminal region; CRP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
Sequence Length
224
Applicable Applications for CRP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CRP blocking peptide
This is a synthetic peptide designed for use in combination with anti-CRP Antibody, made

Target Description: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.
Product Categories/Family for CRP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
C-reactive protein isoform 1
NCBI Official Synonym Full Names
C-reactive protein
NCBI Official Symbol
CRP
NCBI Official Synonym Symbols
PTX1
NCBI Protein Information
C-reactive protein
UniProt Protein Name
C-reactive protein
Protein Family
UniProt Gene Name
CRP
UniProt Synonym Gene Names
PTX1
UniProt Entry Name
CRP_HUMAN

NCBI Description

The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]

Uniprot Description

CRP: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Belongs to the pentaxin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q23.2

Cellular Component: extracellular space; growth cone; extracellular region; filopodium

Molecular Function: choline binding; protein binding; protein homodimerization activity; low-density lipoprotein receptor binding; complement component C1q binding; cholesterol binding; low-density lipoprotein binding; virion binding; calcium ion binding

Biological Process: protein polymerization; defense response to Gram-positive bacterium; response to ethanol; negative regulation of vasodilation; wound healing; positive regulation of superoxide release; response to lead ion; response to hypoxia; acute-phase response; opsonization; inflammatory response; complement activation, classical pathway; aging

Research Articles on CRP

Similar Products

Product Notes

The CRP crp (Catalog #AAA3230993) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CRP Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRP crp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKLLCFLVL TSLSHAFGQT DMSRKAFVFP KESDTSYVSL KAPLTKPLKA. It is sometimes possible for the material contained within the vial of "CRP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.