Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CLEC6A blocking peptide

CLEC6A Peptide - N-terminal region

Gene Names
CLEC6A; CLEC4N; CLECSF10; dectin-2
Reactivity
Human
Applications
Western Blot
Synonyms
CLEC6A; CLEC6A Peptide - N-terminal region; CLEC6A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
Sequence Length
209
Applicable Applications for CLEC6A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CLEC6A blocking peptide
This is a synthetic peptide designed for use in combination with anti-CLEC6A Antibody, made

Target Description: CLEC6A may be involved in regulating immune reactivity.
Product Categories/Family for CLEC6A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
C-type lectin domain family 6 member A isoform 1
NCBI Official Synonym Full Names
C-type lectin domain containing 6A
NCBI Official Symbol
CLEC6A
NCBI Official Synonym Symbols
CLEC4N; CLECSF10; dectin-2
NCBI Protein Information
C-type lectin domain family 6 member A
UniProt Protein Name
C-type lectin domain family 6 member A
UniProt Gene Name
CLEC6A
UniProt Synonym Gene Names
CLECSF10; DECTIN2; DC-associated C-type lectin 2; Dectin-2
UniProt Entry Name
CLC6A_HUMAN

NCBI Description

The protein encoded by this gene is a type II membrane receptor with an extracellular C-type lectin-like domain fold. The extracellular portion binds structures with a high mannose content and has been shown to recognize several pathogens, including C. elegans, S. cerevisiae, M. tuberculosis, C. neoformans, and house dust mite. When stimulated, the encoded protein initiates signalling through the CARD9-Bcl10-Malt1 pathway, leading to the induction of cytokines. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

dectin-2: Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptative immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to membrane

Molecular Function: carbohydrate binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; innate immune response; defense response to fungus; positive regulation of cytokine secretion

Research Articles on CLEC6A

Similar Products

Product Notes

The CLEC6A clec6a (Catalog #AAA3232390) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CLEC6A Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC6A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLEC6A clec6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FIVSCVVTYH FTYGETGKRL SELHSYHSSL TCFSEGTKVP AWGCCPASWK. It is sometimes possible for the material contained within the vial of "CLEC6A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.