Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CLCF1 blocking peptide

CLCF1 Peptide - N-terminal region

Gene Names
CLCF1; CLC; NR6; BSF3; NNT1; BSF-3; CISS2; NNT-1
Reactivity
Human
Synonyms
CLCF1; CLCF1 Peptide - N-terminal region; CLCF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLG
Sequence Length
215
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CLCF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CLCF1 Antibody, made

Target Description: This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for CLCF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
cardiotrophin-like cytokine factor 1 isoform 2
NCBI Official Synonym Full Names
cardiotrophin like cytokine factor 1
NCBI Official Symbol
CLCF1
NCBI Official Synonym Symbols
CLC; NR6; BSF3; NNT1; BSF-3; CISS2; NNT-1
NCBI Protein Information
cardiotrophin-like cytokine factor 1
UniProt Protein Name
Cardiotrophin-like cytokine factor 1
UniProt Gene Name
CLCF1
UniProt Synonym Gene Names
BSF3; CLC; NNT1; BSF-3; NNT-1
UniProt Entry Name
CLCF1_HUMAN

NCBI Description

This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009]

Uniprot Description

CLCF1: Cytokine with B-cell stimulating capability. Binds to and activates the ILST/gp130 receptor. Defects in CLCF1 are the cause of cold-induced sweating syndrome type 2 (CISS2). Cold-induced sweating syndrome (CISS) is an autosomal recessive disorder characterized by profuse sweating induced by cool surroundings (temperatures of 7 to 18 degrees Celsius). Additional abnormalities include a high- arched palate, nasal voice, depressed nasal bridge, inability to fully extend the elbows and kyphoscoliosis. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Apoptosis; Cytokine

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: extracellular region

Molecular Function: protein binding; growth factor activity; protein heterodimerization activity; cytokine activity; ciliary neurotrophic factor receptor binding; receptor binding

Biological Process: positive regulation of immunoglobulin production; cell surface receptor linked signal transduction; B cell differentiation; cytokine and chemokine mediated signaling pathway; positive regulation of cell proliferation; positive regulation of B cell proliferation; negative regulation of neuron apoptosis; JAK-STAT cascade; positive regulation of isotype switching to IgE isotypes; positive regulation of astrocyte differentiation; positive regulation of tyrosine phosphorylation of Stat3 protein

Disease: Cold-induced Sweating Syndrome 2

Research Articles on CLCF1

Similar Products

Product Notes

The CLCF1 clcf1 (Catalog #AAA3246685) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CLCF1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVLWHLPAVP ALNRTGDPGP GPSIQKTYDL TRYLEHQLRS LAGTYLNYLG. It is sometimes possible for the material contained within the vial of "CLCF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.