Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CHMP5 blocking peptide

CHMP5 Peptide - middle region

Gene Names
CHMP5; Vps60; CGI-34; PNAS-2; C9orf83; HSPC177; SNF7DC2
Reactivity
Human
Synonyms
CHMP5; CHMP5 Peptide - middle region; CHMP5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: APPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMV
Sequence Length
171
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CHMP5 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CHMP5 Antibody, made

Target Description: CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.
Product Categories/Family for CHMP5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20 kDa
NCBI Official Full Name
charged multivesicular body protein 5 isoform 2
NCBI Official Synonym Full Names
charged multivesicular body protein 5
NCBI Official Symbol
CHMP5
NCBI Official Synonym Symbols
Vps60; CGI-34; PNAS-2; C9orf83; HSPC177; SNF7DC2
NCBI Protein Information
charged multivesicular body protein 5
UniProt Protein Name
Charged multivesicular body protein 5
UniProt Gene Name
CHMP5
UniProt Synonym Gene Names
C9orf83; SNF7DC2; Vps60; hVps60
UniProt Entry Name
CHMP5_HUMAN

NCBI Description

CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]

Uniprot Description

CHMP5: Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT- III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release. Belongs to the SNF7 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: endosome membrane; nucleus; cytosol

Molecular Function: protein binding

Biological Process: protein transport; viral reproduction; cell separation during cytokinesis; lysosome organization and biogenesis; regulation of receptor recycling; endosome to lysosome transport; viral infectious cycle; endosome transport; mitotic metaphase plate congression; nuclear organization and biogenesis

Research Articles on CHMP5

Similar Products

Product Notes

The CHMP5 chmp5 (Catalog #AAA3247350) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CHMP5 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: APPPSLTDCI GTVDSRAESI DKKISRLDAE LVKYKDQIKK MREGPAKNMV. It is sometimes possible for the material contained within the vial of "CHMP5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.