CERK blocking peptide
CERK Peptide - N-terminal region
Gene Names
CERK; LK4; hCERK; dA59H18.2; dA59H18.3
Reactivity
Human
Synonyms
CERK; CERK Peptide - N-terminal region; CERK blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ADACSVPVSEIIAVEETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARRHR
Sequence Length
537
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CERK blocking peptide
This is a synthetic peptide designed for use in combination with anti- CERK Antibody, made
Target Description: CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation.
Target Description: CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation.
Product Categories/Family for CERK blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
ceramide kinase
NCBI Official Synonym Full Names
ceramide kinase
NCBI Official Symbol
CERK
NCBI Official Synonym Symbols
LK4; hCERK; dA59H18.2; dA59H18.3
NCBI Protein Information
ceramide kinase
UniProt Protein Name
Ceramide kinase
Protein Family
UniProt Gene Name
CERK
UniProt Synonym Gene Names
KIAA1646; hCERK; LK4
NCBI Description
CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008]
Uniprot Description
Catalyzes specifically the phosphorylation of ceramide to form ceramide 1-phosphate. Acts efficiently on natural and analog ceramides (C6, C8, C16 ceramides, and C8-dihydroceramide), to a lesser extent on C2-ceramide and C6-dihydroceramide, but not on other lipids, such as various sphingosines. Binds phosphoinositides.
Research Articles on CERK
Similar Products
Product Notes
The CERK cerk (Catalog #AAA3246449) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CERK Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADACSVPVSE IIAVEETDVH GKHQGSGKWQ KMEKPYAFTV HCVKRARRHR. It is sometimes possible for the material contained within the vial of "CERK, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
