Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IZUMO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit anti-Human IZUMO1 Polyclonal Antibody | anti-IZUMO1 antibody

IZUMO1 antibody - C-terminal region

Gene Names
IZUMO1; OBF; IZUMO
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IZUMO1; Polyclonal Antibody; IZUMO1 antibody - C-terminal region; anti-IZUMO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
Sequence Length
350
Applicable Applications for anti-IZUMO1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IZUMO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IZUMO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-IZUMO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-IZUMO1 antibody
This is a rabbit polyclonal antibody against IZUMO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM].
Product Categories/Family for anti-IZUMO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
izumo sperm-egg fusion protein 1 isoform 1
NCBI Official Synonym Full Names
izumo sperm-egg fusion 1
NCBI Official Symbol
IZUMO1
NCBI Official Synonym Symbols
OBF; IZUMO
NCBI Protein Information
izumo sperm-egg fusion protein 1
UniProt Protein Name
Izumo sperm-egg fusion protein 1
UniProt Gene Name
IZUMO1
UniProt Synonym Gene Names
OBF
UniProt Entry Name
IZUM1_HUMAN

NCBI Description

The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM, Mar 2008]

Uniprot Description

IZUMO1: Involved in the fertilization process. May be involved in the fusion of the sperm with the egg. Belongs to the Izumo family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: acrosomal membrane; integral to membrane; plasma membrane

Molecular Function: protein homodimerization activity; receptor binding

Biological Process: cell adhesion; fusion of sperm to egg plasma membrane; single fertilization; sperm-egg recognition

Research Articles on IZUMO1

Similar Products

Product Notes

The IZUMO1 izumo1 (Catalog #AAA3210320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IZUMO1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IZUMO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IZUMO1 izumo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLALITGLTF AIFRRRKVID FIKSSLFGLG SGAAEQTQVP KEKATDSRQQ. It is sometimes possible for the material contained within the vial of "IZUMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.