CERK blocking peptide

CERK Peptide - C-terminal region

Cat. Num. AAA3241201

• Gene Names: CERK; LK4; hCERK; dA59H18.2; dA59H18.3
• Reactivity: Human
• Applications: Western Blot
• Synonyms: CERK; CERK Peptide - C-terminal region; CERK blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: PSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
• Sequence Length: 537

• Applicable Applications for CERK blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CERK blocking peptide

This is a synthetic peptide designed for use in combination with anti-CERK Antibody, made

Target Description: CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation.

Product Categories/Family for CERK blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 20336726
• NCBI GeneID: 64781
• NCBI Accession #: NP_073603
• NCBI GenBank Nucleotide #: NM_022766
• UniProt Accession #: Q8TCT0
• Molecular Weight: 60kDa
• NCBI Official Full Name: ceramide kinase
• NCBI Official Synonym Full Names: ceramide kinase
• NCBI Official Symbol: CERK
• NCBI Official Synonym Symbols: LK4; hCERK; dA59H18.2; dA59H18.3
• NCBI Protein Information: ceramide kinase
• UniProt Protein Name: Ceramide kinase
• Protein Family: Ceramide kinase
• UniProt Gene Name: CERK
• UniProt Synonym Gene Names: KIAA1646; hCERK; LK4

NCBI Description

CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008]

Uniprot Description

Catalyzes specifically the phosphorylation of ceramide to form ceramide 1-phosphate. Acts efficiently on natural and analog ceramides (C6, C8, C16 ceramides, and C8-dihydroceramide), to a lesser extent on C2-ceramide and C6-dihydroceramide, but not on other lipids, such as various sphingosines. Binds phosphoinositides.