Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CEP70 blocking peptide

CEP70 Peptide - N-terminal region

Gene Names
CEP70; BITE
Reactivity
Human
Applications
Western Blot
Synonyms
CEP70; CEP70 Peptide - N-terminal region; CEP70 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT
Sequence Length
212
Applicable Applications for CEP70 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CEP70 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CEP70 Antibody, made

Target Description: CEP70 plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.
Product Categories/Family for CEP70 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
centrosomal protein of 70 kDa isoform 1
NCBI Official Synonym Full Names
centrosomal protein 70
NCBI Official Symbol
CEP70
NCBI Official Synonym Symbols
BITE
NCBI Protein Information
centrosomal protein of 70 kDa
UniProt Protein Name
Centrosomal protein of 70 kDa
Protein Family
UniProt Gene Name
CEP70
UniProt Synonym Gene Names
BITE; Cep70
UniProt Entry Name
CEP70_HUMAN

Uniprot Description

CEP70: Plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, required for the organization and orientation of the mitotic spindle. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: nucleoplasm; centrosome; nuclear membrane; cytoplasm; cytosol

Molecular Function: protein binding

Biological Process: organelle organization and biogenesis; mitotic cell cycle; G2/M transition of mitotic cell cycle

Research Articles on CEP70

Similar Products

Product Notes

The CEP70 cep70 (Catalog #AAA3238917) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CEP70 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEP70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEP70 cep70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFPVAPKPQD SSQPSDRLMT EKQQEEAEWE SINVLLMMHG LKPLSLVKRT. It is sometimes possible for the material contained within the vial of "CEP70, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.