Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD3EAP blocking peptide

CD3EAP Peptide - N-terminal region

Gene Names
CD3EAP; ASE1; CAST; ASE-1; PAF49
Reactivity
Human
Synonyms
CD3EAP; CD3EAP Peptide - N-terminal region; CD3EAP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNG
Sequence Length
510
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD3EAP blocking peptide
This is a synthetic peptide designed for use in combination with anti- CD3EAP Antibody, made

Target Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation.Isoform 2 has been described as a component of preformed T-cell receptor (TCR) complex.
Product Categories/Family for CD3EAP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
DNA-directed RNA polymerase I subunit RPA34 isoform 1
NCBI Official Synonym Full Names
CD3e molecule associated protein
NCBI Official Symbol
CD3EAP
NCBI Official Synonym Symbols
ASE1; CAST; ASE-1; PAF49
NCBI Protein Information
DNA-directed RNA polymerase I subunit RPA34
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA34
UniProt Gene Name
CD3EAP
UniProt Synonym Gene Names
ASE1; CAST; PAF49; ASE-1; CAST
UniProt Entry Name
RPA34_HUMAN

Uniprot Description

ASE-1: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation. Belongs to the eukaryotic RPA34 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Transcription initiation complex

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleolus; RNA polymerase I transcription factor complex; chromosome; nucleus; DNA-directed RNA polymerase I complex

Molecular Function: DNA-directed RNA polymerase activity

Biological Process: negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; transmembrane receptor protein tyrosine kinase signaling pathway; rRNA transcription

Research Articles on CD3EAP

Similar Products

Product Notes

The CD3EAP cd3eap (Catalog #AAA3247956) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD3EAP Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AARFSCPPNF TAKPPASESP RFSLEALTGP DTELWLIQAP ADFAPECFNG. It is sometimes possible for the material contained within the vial of "CD3EAP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.